You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592775 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CHRNA3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rabbit |
Reactivity | Human, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 57kDa |
Target | CHRNA3 |
UniProt ID | P32297 |
Protein Sequence | Synthetic peptide located within the following region: LPVARASEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVD |
NCBI | NP_000734 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | LNCR2, PAOD2, BAIPRCK, NACHRA3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: CHRNA3, Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/ml.
Host: Rat, Target Name: CHRNA3, Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/ml.
WB Suggested Anti-CHRNA3 Antibody Titration: 0.1 ug/ml, Positive Control: Human Thymus.
FC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating