CHRFAM7A antibody

• Catalog Number: orb592778
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CHRFAM7A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Mouse
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA7
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56 kDa
• Target: CHRNA7
• UniProt ID: P36544
• Protein Sequence: Synthetic peptide located within the following region: QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQV
• NCBI: NP_000737
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NACHRA7, CHRNA7-2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Host: Rabbit, Target Name: CHRNA7, Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: CHRNA7, Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: CHRNA7, Sample Type: MDA-MB-435S Cell lysates, Antibody Dilution: 1.0 ug/ml.

Host: Rat, Target Name: CHRNA7, Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-CHRNA7 Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate.