You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329831 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CHRFAM7A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CHRFAM7A |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 35kDa |
Target | CHRFAM7A |
UniProt ID | Q8IUZ4 |
Protein Sequence | Synthetic peptide located within the following region: QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRM |
NCBI | NP_683709 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | Anti-Alpha 7 neuronal nicotinic acetylcholine rece Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: CHRFAM7A, Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, CHRFAM7A is supported by BioGPS gene expression data to be expressed in 721_B.
Host: Rabbit, Target Name: CHRFAM7A, Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.
WB Suggested Anti-CHRFAM7A Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, CHRFAM7A is supported by BioGPS gene expression data to be expressed in HEK293T.
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating