You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb527021 |
---|---|
Category | Antibodies |
Description | CHM Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human CHM (QDQILENEEAIALSRKDKTIQHVEVFCYASQDLHED). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 100 kDa |
UniProt ID | P24386 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Rab proteins geranylgeranyltransferase component A Read more... |
Note | For research use only |
Application notes | Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml Immunocytochemistry/Immunofluorescence, 5μg/ml Flow Cytometry, 1-3μg/1x10^6 cells |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of U937 cells using anti-CHM antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.
WB analysis of CHM using anti-CHM antibody.Lane 1:human HeLa cell; 2:human placenta tissue; 3:human 293T cell; 4:human A431 cell; 5:human CACO-2 cell; 6:human SiHa cell.
IF analysis of CHM using anti-CHM antibody. CHM was detected in an immunocytochemical section of SiHa cells.
IHC analysis of CHM using anti-CHM antibody. CHM was detected in a paraffin-embedded section of human prostate cancer tissue.
IHC analysis of CHM using anti-CHM antibody. CHM was detected in a paraffin-embedded section of human thyroid cancer tissue.
IHC analysis of CHM using anti-CHM antibody. CHM was detected in a paraffin-embedded section of human tonsil tissue.
IHC-P, WB | |
Bovine, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating