CHM Antibody

• Catalog Number: orb527021
• Category: Antibodies
• Description: CHM Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human CHM (QDQILENEEAIALSRKDKTIQHVEVFCYASQDLHED).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 100 kDa
• UniProt ID: P24386
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Rab proteins geranylgeranyltransferase component A
• Note: For research use only
• Application notes: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml Immunocytochemistry/Immunofluorescence, 5μg/ml Flow Cytometry, 1-3μg/1x10^6 cells
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of U937 cells using anti-CHM antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.

WB analysis of CHM using anti-CHM antibody.Lane 1:human HeLa cell; 2:human placenta tissue; 3:human 293T cell; 4:human A431 cell; 5:human CACO-2 cell; 6:human SiHa cell.

IF analysis of CHM using anti-CHM antibody. CHM was detected in an immunocytochemical section of SiHa cells.

IHC analysis of CHM using anti-CHM antibody. CHM was detected in a paraffin-embedded section of human prostate cancer tissue.

IHC analysis of CHM using anti-CHM antibody. CHM was detected in a paraffin-embedded section of human thyroid cancer tissue.

IHC analysis of CHM using anti-CHM antibody. CHM was detected in a paraffin-embedded section of human tonsil tissue.