You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1820686 |
---|---|
Category | Proteins |
Description | The Chicken IFN alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IFN alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IFN alpha yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IFN alpha Specifications: (Molecular Weight: 19.0 kDa) (Amino Acid Sequence: CNHLRPQDAT FSHDSLQLLR DMAPTLPQLC PQHNASCSFN DTILDTSNTR QADKTTHDIL QHLFKILSSP STPAHWNDSQ RQSLLNRIHR YTQHLEQCLD SSDTRSRTRW PRNLHLTIKK HFSCLHTFLQ DNDYSACAWE HVRLQARAWF LHIHNLTGNT RT (162)) (Gene ID: 396398). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 19.0 kDa |
Target | IFN alpha |
Entrez | 396398 |
Protein Sequence | CNHLRPQDATFSHDSLQLLRDMAPTLPQLCPQHNASCSFNDTILDTSNTRQADKTTHDILQHLFKILSSPSTPAHWNDSQRQSLLNRIHRYTQHLEQCLDSSDTRSRTRWPRNLHLTIKKHFSCLHTFLQDNDYSACAWEHVRLQARAWFLHIHNLTGNTRT (162) |
Protein Length | 162 |
Source | Yeast |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating