You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1820922 |
---|---|
Category | Proteins |
Description | The Chicken CCL20 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL20 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken CCL20 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL20 Specifications: (Molecular Weight: 8.3 kDa) (Amino Acid Sequence: QSNQDCCLSYSKVRLPRKVIKGFTEQLSGEVCDIDAIIFHTVRGLKACVNPKEDWVKKHLLFLSQKLKRMSM) (Gene ID: 395082). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 8.3 kDa |
Target | CCL20 |
Entrez | 395082 |
Protein Sequence | QSNQDCCLSYSKVRLPRKVIKGFTEQLSGEVCDIDAIIFHTVRGLKACVNPKEDWVKKHLLFLSQKLKRMSM |
Protein Length | 72 |
Source | Yeast |
Storage | -20°C |
Alternative names | LARC Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating