You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574279 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CHEK1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CHEK1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 54kDa |
Target | CHEK1 |
UniProt ID | O14757 |
Protein Sequence | Synthetic peptide located within the following region: SARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF |
NCBI | NP_001265 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CHK1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: CHEK1, Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. CHEK1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Host: Rabbit, Target Name: CHEK1, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: CHEK1, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: CHEK1, Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.
Lane 1: 40 ug SH-SY5Y lysate, Lane 2: 40 ug SH-SY5Y lysate, Lane 3: 40 ug HEK293T lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:8000, Gene Name: CHEK1.
Rabbit Anti-CHEK1 antibody, Catalog Number: orb574279, Paraffin Embedded Tissue: Human Heart cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-CHEK1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Small Intestine.
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC | |
Human, Mouse, Rat | |
Monoclonal | |
Unconjugated |
FC, WB | |
Human, Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating