You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579586 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CHAF1B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CHAF1B |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 61kDa |
Target | CHAF1B |
UniProt ID | Q13112 |
Protein Sequence | Synthetic peptide located within the following region: KVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPD |
NCBI | NP_005432 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CAF1, MPP7, CAF-1, CAF1A, CAF1P60, CAF-IP60, MPHOS Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
CHAF1B antibody - N-terminal region (orb579586) validated by WB using Mouse brains at 1:1000.
Host: Rabbit, Target Name: CHAF1B, Sample Type: 293T, Antibody dilution: 1.0 ug/ml. CHAF1B is supported by BioGPS gene expression data to be expressed in HEK293T.
Host: Rabbit, Target Name: CHAF1B, Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. CHAF1B is supported by BioGPS gene expression data to be expressed in HepG2.
Host: Rabbit, Target Name: CHAF1B, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: CHAF1B, Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. CHAF1B is supported by BioGPS gene expression data to be expressed in Jurkat.
WB Suggested Anti-CHAF1B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Liver.
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating