You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581770 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CGAS |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Equine, Guinea pig, Porcine, Rabbit |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human C6orf150 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 59kDa |
Target | CGAS |
UniProt ID | Q8N884 |
Protein Sequence | Synthetic peptide located within the following region: VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDC |
NCBI | NP_612450 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | MB21D1, h-cGAS, C6orf150 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: C6orf150, Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.
Host: Rabbit, Target Name: CGAS, Sample Type: Fetal Liver lysates, Antibody dilution: 0.2 ug/ml.
Host: Rabbit, Target Name: CGAS, Sample Type: Jurkat Whole Cell lysates, Antibody dilution: 0.2 ug/ml.
Host: Rabbit, Target Name: CGAS, Sample Type: Jurkat Whole Cell lysates, Antibody dilution: 0.2 ug/ml.
Host: Rabbit, Target Name: MB21D1, Sample Tissue: Human Jurkat, Antibody dilution: 1.0 ug/ml.
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Canine, Equine, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating