CGAS antibody

• Catalog Number: orb581770
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CGAS
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Porcine, Rabbit
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C6orf150
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 59kDa
• Target: CGAS
• UniProt ID: Q8N884
• Protein Sequence: Synthetic peptide located within the following region: VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDC
• NCBI: NP_612450
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MB21D1, h-cGAS, C6orf150
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: C6orf150, Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Host: Rabbit, Target Name: CGAS, Sample Type: Fetal Liver lysates, Antibody dilution: 0.2 ug/ml.

Host: Rabbit, Target Name: CGAS, Sample Type: Jurkat Whole Cell lysates, Antibody dilution: 0.2 ug/ml.

Host: Rabbit, Target Name: CGAS, Sample Type: Jurkat Whole Cell lysates, Antibody dilution: 0.2 ug/ml.

Host: Rabbit, Target Name: MB21D1, Sample Tissue: Human Jurkat, Antibody dilution: 1.0 ug/ml.