CELF2 antibody

• Catalog Number: orb324885
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CELF2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CUGBP2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56kDa
• Target: CELF2
• UniProt ID: O95319
• Protein Sequence: Synthetic peptide located within the following region: TSAFKLDFLPDMMVEGRLLVPDRINGTANKMNGALDHSDQPDPDAIKMFV
• NCBI: NP_006552
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti BRUNOL3 antibody, anti ETR-3 antibody, anti N
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Fetal Heart tissue using CELF2 antibody

Western blot analysis of human Lung tissue using CELF2 antibody

Host: Rabbit, Target Name: CELF2, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Immunohistochemistry with Spleen tissue at an antibody concentration of 5 ug/mL using anti-CUGBP2 antibody (orb324885).

WB Suggested Anti-CUGBP2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human Lung.