CELF2 antibody

• Catalog Number: orb324846
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CELF2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CUGBP2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56kDa
• Target: CELF2
• UniProt ID: Q96RQ6
• Protein Sequence: Synthetic peptide located within the following region: VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHP
• NCBI: NP_006552
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ETR3 antibody, anti ETR-3 antibody, anti NAPO
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human Lung tissue using CELF2 antibody

Western blot analysis of Jurkat cell lysate tissue using CELF2 antibody

Immunohistochemical staining of human Heart tissue using CELF2 antibody

Host: Rabbit, Target Name: CUGBP2, Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.

Rabbit Anti-CELF2 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

Rabbit Anti-CUGBP2 Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-CUGBP2 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, CELF2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.