CEACAM6 antibody

• Catalog Number: orb578095
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CEACAM6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CEACAM6
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 38kDa
• Target: CEACAM6
• UniProt ID: P40199
• Protein Sequence: Synthetic peptide located within the following region: EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNP
• NCBI: NP_002474
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NCA, CEAL, CD66c
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: CEACAM6, Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.25 ug/ml, Peptide Concentration: 1.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Host: Rabbit, Target: CEACAM6, Positive control (+): Human Stomach Tumor (T-ST), Negative control (-): 293T Cell Lysate (2T), Antibody concentration: 0.5 ug/ml.

Rabbit Anti-CEACAM6 Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Alveolar cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-CEACAM6 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.