CDK20 Rabbit Polyclonal Antibody

• Catalog Number: orb585244
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CDK20
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 37kDa
• Target: CDK20
• UniProt ID: A2A390
• Protein Sequence: Synthetic peptide located within the following region: FGLARVFSPDGSRLYTHQVATRSVGCIMGELLNGSPLFPGKNDIEQLCYV
• NCBI: NP_848519
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: P42, CCRK, CDCH, PNQALRE
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 293T, Antibody dilution: 1.0 ug/ml. CDK20 is supported by BioGPS gene expression data to be expressed in HEK293T.

WB Suggested Anti-CDK20 Antibody, Titration: 1.0 ug/ml, Positive Control: RPMI-8226 Whole Cell.