You have no items in your shopping cart.
Cart summary
Item 1 of 1
CDH6 antibody
Catalog Number: orb589028
| Catalog Number | orb589028 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CDH6 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CDH6 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 88 kDa |
| Target | CDH6 |
| UniProt ID | P55285 |
| Protein Sequence | Synthetic peptide located within the following region: KRALELSGNSKNELNRSKRSWMWNQFFLLEEYTGSDYQYVGKLHSDQDRG |
| NCBI | NP_004923.1 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | CAD6, KCAD Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: CDH6, Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1.0 ug/ml.
- Item 1 of 6
Anti-CDH6 / K-Cadherin Reference Antibody [orb1806273]
ELISA, FA, FACS, Kinetics
Human
Monoclonal
Unconjugated
50 μg, 100 μg, 1 mg, 5 mg - Item 1 of 4
K Cadherin antibody [orb100681]
FC
Bovine, Equine, Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl - Item 1 of 3
- Item 1 of 3
- Item 1 of 3
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
