You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585721 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CDC73 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 58kDa |
Target | CDC73 |
UniProt ID | Q6P1J9 |
Protein Sequence | Synthetic peptide located within the following region: KFVPSDEKKKQGCQRENETLIQRRKDQMQPGGTAISVTVPYRVVDQPLKL |
NCBI | NP_078805 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HYX, FIHP, HPTJT, HRPT1, HRPT2, C1orf28 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-CDC73 Antibody, Titration: 1.0 ug/ml, Positive Control: MDA-MB-435S Whole Cell.
FC, IF, IHC-P, WB | |
Gallus, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating