CD9 antibody

• Catalog Number: orb331123
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CD9
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Porcine, Rabbit, Rat, Sheep
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CD9
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 25 kDa
• Target: CD9
• UniProt ID: P21926
• Protein Sequence: Synthetic peptide located within the following region: KYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGV
• NCBI: NP_001760
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti 5H9 antibody, anti BA2 antibody, anti BTCC-1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Fetal heart tissue using CD9 antibody

Western blot analysis of mouse fibroblast tissue using CD9 antibody

25 ug of THP-1 whole cell extract was loaded onto a 12% SDS-PAGE gel. Blot was incubated with 3 ug/ml of antibody.

CD9 antibody - N-terminal region (orb331123) validated by WB using Fetal Heart Lysate at 1.0 ug/ml.

Host: Rabbit, Target Name: CD9, Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: mouse fibroblast lusate (10 ug) Primary dilution: 1:2000 (1% BSA) Secondary dilution: 1:2000 (5% milk).