CD86 antibody

• Catalog Number: orb585497
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CD86
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Porcine
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 30kDa
• Target: CD86
• UniProt ID: P42081
• Protein Sequence: Synthetic peptide located within the following region: DVTSNMTIFCILETDKTRLLSSPFSIGTNTMEREESEQTKKREKIHIPER
• NCBI: NP_795711
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: B70, B7-2, B7.2, LAB72, CD28LG2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-CD86 Antibody, Titration: 1.0 ug/ml, Positive Control: COLO205 Whole Cell.