You have no items in your shopping cart.
Cart summary
CD85A Recombinant Protein
Catalog Number: orb1495137
| Catalog Number | orb1495137 |
|---|---|
| Category | Proteins |
| Description | CD85A Recombinant Protein |
| Species/Host | E. coli |
| Tag | His-tag |
| MW | ~52kDa |
| UniProt ID | O75022 |
| Solubility (25°C) | PBS, 4M Urea, PH7.4 |
| Protein Sequence | GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE |
| Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Buffer/Preservatives | PBS, 4M Urea, pH 7.4 |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
LILRB3 Recombinant Protein [orb1227743]
WB
> 92% as determined by SDS-PAGE.Endotoxin level is less than 1.0 EU per ug by the LAL method.
48 kDa
HEK293 cells
0.1 mg - Item 1 of 1
LILRB3 Recombinant Protein [orb1227744]
WB
> 95% as determined by SDS-PAGE.Endotoxin level is less than 1.0 EU per ug by the LAL method.
72.8 kDa
HEK293 cells
0.1 mg Recombinant Human CD85A/LILRB3 Protein, His Tag [orb1553373]
≥90% as determined by SDS-PAGE
This protein contains the human LILRB3(Met1-Glu443) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
