You have no items in your shopping cart.
Cart summary
CD62E Recombinant Protein
Catalog Number: orb1495147
| Catalog Number | orb1495147 |
|---|---|
| Category | Proteins |
| Description | CD62E Recombinant Protein |
| Species/Host | E. coli |
| Tag | His-tag |
| MW | ~62kDa |
| UniProt ID | P16581 |
| Solubility (25°C) | PBS, 4M Urea, PH7.4 |
| Protein Sequence | MWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP |
| Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Buffer/Preservatives | PBS, 4M Urea, pH 7.4 |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human E-selectin protein [orb392430]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman CD62E Protein, His Tag [orb1826758]
Unconjugated
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 59.5 kDa after removal of the signal peptide. The apparent molecular mass of CD62E-His is approximately 100-130 kDa due to glycosylation.
Mammalian
100 μg, 50 μg, 10 μg- Item 1 of 1
E-Selectin Recombinant Protein [orb1227769]
WB
> 95% as determined by SDS-PAGE.Endotoxin level is less than 1.0 EU per ug by the LAL method.
84.8 kDa
HEK293 cells
0.1 mg - Item 1 of 1
E Selectin Recombinant Protein [orb1228119]
WB
> 95% as determined by SDS-PAGE.
60 kDa
HEK293 cells
0.2 mg Porcine SELE Protein [orb1477583]
Greater than 90% as determined by SDS-PAGE.
44.4 kDa
E.coli
20 μg, 100 μg, 1 mg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
