You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb315155 |
---|---|
Category | Antibodies |
Description | CD41/Integrin alpha 2b/ITGA2B Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human ITGA2B (677-711aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN), different from the related mouse sequence by four amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 113377 MW |
UniProt ID | P08514 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Integrin alpha-IIb;GPalpha IIb;GPIIb;Platelet memb Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of ITGA2B using anti-ITGA2B antibody.Lane 1:human HEL cell;2:human HEL cell;3:human K562 cell.
IHC analysis of ITGA2B using anti-ITGA2B antibody. ITGA2B was detected in a paraffin-embedded section of human mammary cancer tissue.
IHC analysis of ITGA2B using anti-ITGA2B antibody. ITGA2B was detected in a paraffin-embedded section of mouse lung tissue.
IHC analysis of ITGA2B using anti-ITGA2B antibody. ITGA2B was detected in a paraffin-embedded section of rat lung tissue.
ELISA, FC, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating