Cart summary

You have no items in your shopping cart.

    CD41/Integrin alpha 2b/ITGA2B Antibody

    Catalog Number: orb315155

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb315155
    CategoryAntibodies
    DescriptionCD41/Integrin alpha 2b/ITGA2B Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsIHC, WB
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human ITGA2B (677-711aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN), different from the related mouse sequence by four amino acids.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW113377 MW
    UniProt IDP08514
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesIntegrin alpha-IIb;GPalpha IIb;GPIIb;Platelet memb
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    CD41/Integrin alpha 2b/ITGA2B Antibody

    WB analysis of ITGA2B using anti-ITGA2B antibody.Lane 1:human HEL cell;2:human HEL cell;3:human K562 cell.

    CD41/Integrin alpha 2b/ITGA2B Antibody

    IHC analysis of ITGA2B using anti-ITGA2B antibody. ITGA2B was detected in a paraffin-embedded section of human mammary cancer tissue.

    CD41/Integrin alpha 2b/ITGA2B Antibody

    IHC analysis of ITGA2B using anti-ITGA2B antibody. ITGA2B was detected in a paraffin-embedded section of mouse lung tissue.

    CD41/Integrin alpha 2b/ITGA2B Antibody

    IHC analysis of ITGA2B using anti-ITGA2B antibody. ITGA2B was detected in a paraffin-embedded section of rat lung tissue.

    • CD41/Integrin Alpha 2B/ITGA2B Antibody [orb1676335]

      ELISA,  FC,  IHC,  WB

      Human

      Rabbit

      Polyclonal

      Unconjugated

      10 μg, 100 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars