You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574842 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CD40LG |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CD40LG |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 29kDa |
Target | CD40LG |
UniProt ID | P29965 |
Protein Sequence | Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
NCBI | NP_000065 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | IGM, IMD3, TRAP, gp39, CD154, CD40L, HIGM1, T-BAM, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: CD40LG, Sample Type: Human Fetal Muscle, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.
Immunohistochemistry with Thymus tissue at an antibody concentration of 5 ug/ml using anti-CD40LG antibody (orb574842).
WB Suggested Anti-CD40LG Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.
ELISA, FACS, IF, IHC-P | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
ELISA, FACS, IF, IHC-P | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
FC, IF, IHC-P, WB | |
Bovine, Porcine | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
Filter by Rating