CD36 antibody

• Catalog Number: orb580287
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CD36
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CD36
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 53kDa
• Target: CD36
• UniProt ID: P16671
• Protein Sequence: Synthetic peptide located within the following region: MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIA
• NCBI: NP_001001547
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: FAT, GP4, GP3B, GPIV, CHDS7, PASIV, SCARB3, BDPLT1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 32 kDa.

Host: Rabbit, Target Name: CD36, Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Immunohistochemistry with HepG2 cell lysate tissue at an antibody concentration of 1 ug/ml using anti-CD36 antibody (orb580287).

Rabbit Anti-CD36 Antibody, Paraffin Embedded Tissue: Human hepatocyte, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-CD36 Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate.