CD34 monoclonal antibody (M01), clone 5F3

• Catalog Number: orb2294810
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CD34.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5F3
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: CD34 (NP_001764, 32 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPG
• NCBI: NP_001764
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged CD34 is approximately 0.3 ng/ml as a capture antibody.

Western Blot detection against Immunogen (37.84 KDa).