You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584866 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CD34 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Canine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CD34 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 35kDa |
Target | CD34 |
UniProt ID | Q3C1E7 |
Protein Sequence | Synthetic peptide located within the following region: DLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRR |
NCBI | NP_001764 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human fetal heart using CD34 antibody.
Western blot analysis of human THP-1 whole cell using CD34 antibody.
Immunohistochemical staining of human kidney using CD34 antibody.
Host: Rabbit, Target Name: CD34, Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Type: Human kidney, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Color/Signal Descriptions: Brown: CD34 Blue: DAPI, Gene Name: CD34.
WB Suggested Anti-CD34 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Heart.
FACS, IF, IHC-P, WB | |
Human, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating