You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1495156 |
---|---|
Category | Proteins |
Description | CD33 Recombinant Protein |
Species/Host | E. coli |
Tag | His-tag |
MW | ~33kDa |
UniProt ID | P20138 |
Solubility (25°C) | PBS, 4M Urea, PH7.4 |
Protein Sequence | DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNK LDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVH VTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVL IITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGV VH |
Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Buffer/Preservatives | PBS, 4M Urea, pH 7.4 |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 50.8 kDa after removal of the signal peptide.The apparent molecular mass of mCD33-hFc is approximately 55-70 kDa due to glycosylation. | |
Mammalian |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 38.9 kDa after removal of the signal peptide. | |
Mammalian |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 53.8 kDa after removal of the signal peptide. | |
Mammalian |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 53.6 kDa after removal of the signal peptide.The apparent molecular mass of SIGLEC15-mFc-His is approximately 55-70 kDa due to glycosylation. | |
Mammalian |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
Human cells |
Filter by Rating