Cart summary

You have no items in your shopping cart.

    CD33 Recombinant Protein

    CD33 Recombinant Protein

    Catalog Number: orb1495156

    DispatchUsually dispatched within 5-10 working days
    $ 1,228.00
    Catalog Numberorb1495156
    CategoryProteins
    DescriptionCD33 Recombinant Protein
    Species/HostE. coli
    TagHis-tag
    MW~33kDa
    UniProt IDP20138
    Solubility (25°C)PBS, 4M Urea, PH7.4
    Protein SequenceDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNK LDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVH VTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVL IITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGV VH
    StorageStore at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
    Buffer/PreservativesPBS, 4M Urea, pH 7.4
    NoteFor research use only
    Expiration Date6 months from date of receipt.
    • Mouse CD33 Protein, hFc Tag [orb1173692]

      Unconjugated

      The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.

      The protein has a predicted molecular mass of 50.8 kDa after removal of the signal peptide.The apparent molecular mass of mCD33-hFc is approximately 55-70 kDa due to glycosylation.

      Mammalian

      100 μg, 10 μg, 50 μg
    • Human CD33(140-259) Protein, hFc Tag [orb1173772]

      Unconjugated

      The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.

      The protein has a predicted molecular mass of 38.9 kDa after removal of the signal peptide.

      Mammalian

      100 μg, 10 μg, 50 μg
    • Human CD33(18-259) Protein, hFc-His Tag [orb689399]

      Unconjugated

      The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.

      The protein has a predicted molecular mass of 53.8 kDa after removal of the signal peptide.

      Mammalian

      10 μg, 50 μg, 100 μg
    • Human SIGLEC15 Protein, mFc-His Tag [orb689444]

      Unconjugated

      The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.

      The protein has a predicted molecular mass of 53.6 kDa after removal of the signal peptide.The apparent molecular mass of SIGLEC15-mFc-His is approximately 55-70 kDa due to glycosylation.

      Mammalian

      10 μg, 50 μg, 100 μg
    • Human CD33 protein [orb391407]

      ELISA,  MS,  SDS-PAGE,  WB

      Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

      Human cells

      500 μg, 50 μg, 10 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars