You have no items in your shopping cart.
Cart summary
CD317 Recombinant Protein
Catalog Number: orb1495151
| Catalog Number | orb1495151 |
|---|---|
| Category | Proteins |
| Description | CD317 Recombinant Protein |
| Species/Host | E. coli |
| Tag | His-tag |
| MW | ~16kDa |
| UniProt ID | Q10589 |
| Solubility (25°C) | PBS, 4M Urea, PH7.4 |
| Protein Sequence | MNSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS |
| Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Buffer/Preservatives | PBS, 4M Urea, pH 7.4 |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human BST2 protein [orb391311]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman BST2 Protein, hFc Tag [orb1290831]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 38.8 kDa after removal of the signal peptide.The apparent molecular mass of hFc-BST2 is approximately 40-55 kDa due to glycosylation.
Mammalian
100 μg, 50 μg, 10 μgBST2 Recombinant Protein [orb1229138]
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.13.67 kD
Human Cells
0.05 mgRecombinant Human CD317/BST2 Protein, Gst Tag [orb1553162]
≥90% as determined by SDS-PAGE
This protein contains the human BST2(Ser50-Ser161) was fused with the N-terminal Gst Tag and expressed in E. coli.
100 μg, 50 μgRecombinant Human BST2 Protein, His Tag [orb1552822]
≥90% as determined by SDS-PAGE
This protein contains the human BST2(Asn49-Ser161) was fused with the C-terminal His Tag and expressed in Mammalian cells.
50 μg, 100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
