CD303 Recombinant Protein

Catalog Number: orb1495123

Catalog Number	orb1495123
Category	Proteins
Description	CD303 Recombinant Protein
Species/Host	E. coli
Tag	His-tag
MW	~23kDa
UniProt ID	Q8WTT0
Solubility (25°C)	PBS, 4M Urea, PH7.4
Protein Sequence	NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Buffer/Preservatives	PBS, 4M Urea, pH 7.4
Note	For research use only
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 20.3 kDa after removal of the signal peptide. The apparent molecular mass of His-cCLEC4C is approximately 15-25 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 100 μg, 50 μg, 10 μg

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 20.8 kDa after removal of the signal peptide. The apparent molecular mass of CLEC4C-His is approximately 25-35 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 100 μg, 50 μg, 10 μg

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 46.1 kDa after removal of the signal peptide. The apparent molecular mass of hFc-CLEC4C is approximately 55-70 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 50 μg, 10 μg, 100 μg

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	24 kDa
Source:	Mammalian cell

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	22 kDa
Source:	Yeast