You have no items in your shopping cart.
Cart summary
CD301 Recombinant Protein
Catalog Number: orb1495124
| Catalog Number | orb1495124 |
|---|---|
| Category | Proteins |
| Description | CD301 Recombinant Protein |
| Species/Host | E. coli |
| Tag | His-tag |
| MW | ~30kDa |
| UniProt ID | Q8IUN9 |
| Solubility (25°C) | PBS, 4M Urea, PH7.4 |
| Protein Sequence | QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH |
| Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Buffer/Preservatives | PBS, 4M Urea, pH 7.4 |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human CLEC10A protein [orb391484]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgCLEC10A Recombinant Protein [orb1229361]
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.29.8 kD
Human Cells
0.05 mgRecombinant Human CD301/CLEC10A Protein, Fc Tag [orb1553174]
≥90% as determined by SDS-PAGE
This protein contains the human CLEC10A(Gln61-Asn292) was fused with the N-terminal Fc Tag and expressed in Mammalian cells.
100 μg, 50 μgRecombinant Human CLEC10A/MGL1/CD301 Protein, His Tag [orb1550973]
> 90% by SDS-PAGE.
KMP1514, Recombinant Human CLEC10A/MGL1/CD301 Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Gln61-His Tag316) of human CLEC10A/MGL1/CD301 (Accession #NP_878910.1) fused with a 6×His Tag at the C-terminus.
50 μg, 100 μgRecombinant Human CLEC10A Protein, His Tag [orb1552677]
≥90% as determined by SDS-PAGE
This protein contains the human CLEC10A(Gln61-His316) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
