You have no items in your shopping cart.
Cart summary
CD300LB Recombinant Protein
Catalog Number: orb1495163
| Catalog Number | orb1495163 |
|---|---|
| Category | Proteins |
| Description | CD300LB Recombinant Protein |
| Species/Host | E. coli |
| Tag | His-tag |
| MW | ~18kDa |
| UniProt ID | J9JID3 |
| Solubility (25°C) | PBS, 4M Urea, PH7.4 |
| Protein Sequence | MIQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY |
| Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Buffer/Preservatives | PBS, 4M Urea, pH 7.4 |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human CD300LB protein [orb246728]
Greater than 90% as determined by SDS-PAGE.
17.2 kDa
Yeast
20 μg, 100 μg, 500 μg, 1 mgHuman CD300LB protein [orb624004]
Greater than 85% as determined by SDS-PAGE.
18.8 kDa
E.coli
20 μg, 100 μg, 1 mg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
