You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1495152 |
---|---|
Category | Proteins |
Description | CD299 Recombinant Protein |
Species/Host | E. coli |
Tag | His-tag |
MW | ~38kDa |
UniProt ID | Q9H2X3 |
Solubility (25°C) | PBS, 4M Urea, PH7.4 |
Protein Sequence | MQVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE |
Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Buffer/Preservatives | PBS, 4M Urea, pH 7.4 |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
≥90% as determined by SDS-PAGE | |
This protein contains the human Q9H2X3(Ser78-Glu399) was fused with the N-terminal Fc Tag and expressed in Mammalian cells. |
Filter by Rating