CD267 Recombinant Protein

Catalog Number: orb1495168

Catalog Number	orb1495168
Category	Proteins
Description	CD267 Recombinant Protein
Species/Host	E. coli
Tag	His-tag
MW	~22kDa
UniProt ID	O14836
Solubility (25°C)	PBS, 4M Urea, PH7.4
Protein Sequence	MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYS
Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Buffer/Preservatives	PBS, 4M Urea, pH 7.4
Note	For research use only
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 44.5 kDa after removal of the signal peptide.The apparent molecular mass of TACI-hFc is approximately 33-53 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 10 μg, 50 μg, 100 μg

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 40.2 kDa after removal of the signal peptide. The apparent molecular mass of mTACI-hFc is approximately 40-55 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 50 μg, 10 μg, 100 μg

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells

Purity:	Greater than 95% as determined by reducing SDS-PAGE. Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
MW:	41.4 kD
Source:	Human Cells

Purity:	> 90% (SDS-PAGE). Endotoxin level is less than 0.01EU/ μg purified protein (LAL test; Lonza).
Source:	HEK293 cells