You have no items in your shopping cart.
Cart summary
CD258 Recombinant Protein
Catalog Number: orb1495116
| Catalog Number | orb1495116 |
|---|---|
| Category | Proteins |
| Description | CD258 Recombinant Protein |
| Species/Host | E. coli |
| Tag | His-tag |
| MW | ~20kDa |
| UniProt ID | O43557 |
| Solubility (25°C) | PBS, 4M Urea, PH7.4 |
| Protein Sequence | LQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV |
| Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Buffer/Preservatives | PBS, 4M Urea, pH 7.4 |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 2
Human TNFSF14 protein [orb705344]
Greater than 85% as determined by SDS-PAGE.
46.7 kDa
Mammalian cell
20 μg, 100 μg, 1 mg - Item 1 of 2
LIGHT / TNFSF14 Recombinant Protein [orb1231227]
ELISA, WB
> 95% as determined by SDS-PAGE.
45.1 kDa
HEK293 cells
0.1 mg Human TNFSF14 protein [orb706862]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman LIGHT Protein, hFc Tag [orb757459]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 43.4 kDa after removal of the signal peptide.
Mammalian
100 μg, 10 μg, 50 μgHuman TNFSF14 protein [orb605256]
Greater than 90% as determined by SDS-PAGE.
48.3 kDa
Mammalian cell
20 μg, 100 μg, 1 mg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
