You have no items in your shopping cart.
Cart summary
CD242 Recombinant Protein
Catalog Number: orb1495164
| Catalog Number | orb1495164 |
|---|---|
| Category | Proteins |
| Description | CD242 Recombinant Protein |
| Species/Host | E. coli |
| Tag | His-tag |
| MW | ~28kDa |
| UniProt ID | Q14773 |
| Solubility (25°C) | PBS, 4M Urea, PH7.4 |
| Protein Sequence | MALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLRCHVTQVFPVGYLVVTLRHGSRVIYSESLERFTGLDLANVTLTYEFAAGPRDFWQPVICHARLNLDGLVVRNSSAPITLMLAWSPAPTA |
| Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Buffer/Preservatives | PBS, 4M Urea, pH 7.4 |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Mouse Icam4 protein [orb358404]
Greater than 90% as determined by SDS-PAGE.
39.1 kDa
E.coli
20 μg, 100 μg, 1 mgRecombinant Human CD242/ICAM4 Protein, His Tag [orb1553224]
≥90% as determined by SDS-PAGE
This protein contains the human ICAM4(Met1-Ala240) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μgHuman ICAM4 protein [orb755958]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
18.4 kDa
E.Coli
100 μg, 1 mg, 200 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
