You have no items in your shopping cart.
Cart summary
CD23A Recombinant Protein
Catalog Number: orb1495157
| Catalog Number | orb1495157 |
|---|---|
| Category | Proteins |
| Description | CD23A Recombinant Protein |
| Species/Host | E. coli |
| Tag | His-tag |
| MW | ~35kDa |
| UniProt ID | P06734 |
| Solubility (25°C) | PBS, 4M Urea, PH7.4 |
| Protein Sequence | MDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS |
| Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Buffer/Preservatives | PBS, 4M Urea, pH 7.4 |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human CD23 Protein, His Tag [orb1173820]
Unconjugated
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 31.8 kDa after removal of the signal peptide. The apparent molecular mass of His-CD23 is approximately 35-55 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μgHuman FCER2 protein [orb706856]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgSoluble CD23 Recombinant Protein [orb1230794]
Greater than 96% by SDS-PAGE gel and HPLC analyses.Endotoxin level is less than 0.1 ng per μg (1EU/μg).
E. coli
0.02 mg, 0.005 mgRecombinant Human CD23/FCER2 Protein, His Tag [orb1553445]
≥90% as determined by SDS-PAGE
This protein contains the human FCER2(Asp48-Ser321) was fused with the N-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μgRecombinant Human FCER2/CD23 Protein, His Tag [orb1552432]
≥90% as determined by SDS-PAGE
This protein contains the human FCER2(Asp48-Ser321) was fused with the N-terminus His Tag and expressed in Mammalian cells.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
