You have no items in your shopping cart.
Cart summary
CD235a Recombinant Protein
Catalog Number: orb1495141
| Catalog Number | orb1495141 |
|---|---|
| Category | Proteins |
| Description | CD235a Recombinant Protein |
| Species/Host | E. coli |
| Tag | His-tag |
| MW | ~11kDa |
| UniProt ID | P02724 |
| Solubility (25°C) | PBS, 4M Urea, PH7.4 |
| Protein Sequence | MSSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE |
| Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Buffer/Preservatives | PBS, 4M Urea, pH 7.4 |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human CD235A Protein, hFc Tag [orb1290967]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 33.3 kDa after removal of the signal peptide. The apparent molecular mass of CD235A-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μg- Item 1 of 1
Glycophorin A Recombinant Protein [orb1228126]
WB
> 95% as determined by SDS-PAGE.
39.1 kDa
HEK293 cells
0.05 mg Human GYPA protein [orb604144]
Greater than 90% as determined by SDS-PAGE.
12 kDa
E.coli
200 μg, 100 μg, 1 mg, 20 μgRecombinant Human CD235A/GYPA Protein, His Tag [orb1553228]
≥90% as determined by SDS-PAGE
This protein contains the human GYPA(Met1-Glu91) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
