CD230 Recombinant Protein

Catalog Number: orb1495162

Catalog Number	orb1495162
Category	Proteins
Description	CD230 Recombinant Protein
Species/Host	E. coli
Tag	His-tag
MW	~30kDa
UniProt ID	P04156
Solubility (25°C)	PBS, 4M Urea, PH7.4
Protein Sequence	MKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGS
Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Buffer/Preservatives	PBS, 4M Urea, pH 7.4
Note	For research use only
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 42.2 kDa after removal of the signal peptide. The apparent molecular mass of PRNP(90-230)-hFc is approximately 55-70 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 50 μg, 10 μg, 100 μg

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 48.8 kDa after removal of the signal peptide. The apparent molecular mass of PRNP-hFc is approximately 55-70 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 10 μg, 100 μg, 50 μg

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	30.3 kDa
Source:	E.coli

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human PRNP(Met1-Ser230) was fused with the C-terminal Fc Tag and expressed in Mammalian cells.