You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb526997 |
---|---|
Category | Antibodies |
Description | CD229/LY9 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human CD229/LY9 (YKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMK). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
UniProt ID | Q9HBG7 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | T-lymphocyte surface antigen Ly-9; Cell surface mo Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of U937 cells using anti-CD229 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of Jurkat cells using anti-CD229 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of Daudi cells using anti-CD229 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
IHC analysis of CD229 using anti-CD229 antibody.CD229 was detected in paraffin-embedded section of mouse spleen tissues.
IHC analysis of CD229 using anti-CD229 antibody.CD229 was detected in paraffin-embedded section of rat spleen tissues.
IHC analysis of CD229 using anti-CD229 antibody.CD229 was detected in paraffin-embedded section of mouse spleen tissues.
IHC analysis of CD229 using anti-CD229 antibody.CD229 was detected in paraffin-embedded section of rat spleen tissues.
Filter by Rating