You have no items in your shopping cart.
Cart summary
CD208 Recombinant Protein
Catalog Number: orb1495138
| Catalog Number | orb1495138 |
|---|---|
| Category | Proteins |
| Description | CD208 Recombinant Protein |
| Species/Host | E. coli |
| Tag | His-tag |
| MW | ~47kDa |
| UniProt ID | Q9UQV4 |
| Solubility (25°C) | PBS, 4M Urea, PH7.4 |
| Protein Sequence | KAFPETRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDYT |
| Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Buffer/Preservatives | PBS, 4M Urea, pH 7.4 |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human LAMP3 Protein, His Tag [orb1291780]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 38.6 kDa after removal of the signal peptide. The apparent molecular mass of LAMP3-His is approximately 35-130 kDa due to glycosylation.
Mammalian
100 μg, 50 μg, 10 μgRecombinant Human CD208/LAMP3 Protein, His Tag [orb1553250]
≥90% as determined by SDS-PAGE
This protein contains the human LAMP3(Lys28-Thr381) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μgRecombinant Human CD208 [orb1099742]
ELISA, WB
Greater than 95% by SDS-PAGE gel analyses
46.9 kDa
E.Coli
100 μg, 1 mg, 200 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
