You have no items in your shopping cart.
Cart summary
CD207 Recombinant Protein
Catalog Number: orb1495167
| Catalog Number | orb1495167 |
|---|---|
| Category | Proteins |
| Description | CD207 Recombinant Protein |
| Species/Host | E. coli |
| Tag | His-tag |
| MW | ~35kDa |
| UniProt ID | Q9UJ71 |
| Solubility (25°C) | PBS, 4M Urea, PH7.4 |
| Protein Sequence | PRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFL KLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKL LKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYK TAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQ AWNDAPCDKTFLFICKRPYVPSEP |
| Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Buffer/Preservatives | PBS, 4M Urea, pH 7.4 |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Mouse Cd207 protein [orb54188]
Greater than 90% as determined by SDS-PAGE.
34.7 kDa
E.coli
20 μg, 100 μg, 1 mgMouse Cd207 protein [orb605283]
Greater than 85% as determined by SDS-PAGE.
34.8 kDa
Mammalian cell
20 μg, 100 μg, 1 mgRecombinant Human CD207 Protein, His Tag [orb1553251]
≥90% as determined by SDS-PAGE
This protein contains the human CD207(Pro65-Pro328) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
