CD155 antibody

• Catalog Number: orb585504
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CD155
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 45kDa
• Target: PVR
• UniProt ID: P15151
• Protein Sequence: Synthetic peptide located within the following region: FHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVT
• NCBI: NP_006496
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PVS, HVED, CD155, NECL5, TAGE4, Necl-5
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target: PVR, Positive control (+): Hela (HL), Negative control (-): Human brain (BR), Antibody concentration: 1 ug/ml.

Application: IHC, Species+tissue/cell type: Human Keratinocytes, Primary antibody dilution: 1:200, Secondary Antibody: Anti-rabbit Dylight 488, Secondary antibody dilution: 1:500.

WB Suggested Anti-PVR Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.