You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579589 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CCT8 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rat, Yeast, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CCT8 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 59kDa |
Target | CCT8 |
UniProt ID | Q5RAP1 |
Protein Sequence | Synthetic peptide located within the following region: DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK |
NCBI | NP_006576 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | Cctq, PRED71, D21S246, C21orf112 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
CCT8 antibody - C-terminal region (orb579589) validated by WB using HEK 293T at 1:1000 dilution for antibody samples and 1:10000 for secondary antibodies. CCT8 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
CCT8 antibody - C-terminal region (orb579589) validated by WB using human lymphoblastoid & mouse brain.
Host: Mouse, Target Name: CCT8, Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: CCT8, Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.
WB Suggested Anti-CCT8 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. CCT8 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.
FC, ICC, IF, IHC, IHC-Fr, WB | |
Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating