You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575007 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CCT4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CCT4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 58kDa |
Target | CCT4 |
UniProt ID | Q53QP9 |
Protein Sequence | Synthetic peptide located within the following region: AFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISN |
NCBI | NP_006421 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | SRB, Cctd, CCT-DELTA Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: CCT4, Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.
Host: Rabbit, Target Name: CCT4, Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.
Rabbit Anti-CCT4 Antibody, Catalog Number: orb575007, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Sample Type: Rat Hippocampal Neurons - 14DIV, Primary Antibody dilution: 1:200, Secondary Antibody: Anti-rabbit-Cy3, Secondary Antibody dilution: 1:500, Color/Signal Descriptions: White: CCT4, Gene Name: CCT4.
FC, ICC, IF, IHC, IHC-Fr, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating