Cart summary

You have no items in your shopping cart.

    CCT3 Antibody

    Catalog Number: orb371660

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb371660
    CategoryAntibodies
    DescriptionCCT3 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IF, IHC, IHC-Fr, WB
    ReactivityHuman, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497-536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ), different from the related mouse and rat sequences by one amino acid.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW60534 MW
    UniProt IDP49368
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesT-complex protein 1 subunit gamma;TCP-1-gamma;CCT-
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    CCT3 Antibody

    Flow Cytometry analysis of PC-3 cells using anti-CCT3 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    CCT3 Antibody

    Flow Cytometry analysis of K562 cells using anti-CCT3 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control

    CCT3 Antibody

    Flow Cytometry analysis of U251 cells using anti-CCT3 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    CCT3 Antibody

    WB analysis of CCT3 using anti-CCT3 antibody.Lane 1:rat kidney tissue;2:HELA cell.

    CCT3 Antibody

    IF analysis of CCT3 using anti-CCT3 antibody.CCT3 was detected in immunocytochemical section of A431 cell.

    CCT3 Antibody

    IF analysis of CCT3 using anti-CCT3 antibody.CCT3 was detected in immunocytochemical section of A431 cell.

    CCT3 Antibody

    IHC analysis of CCT3 using anti-CCT3 antibody.CCT3 was detected in paraffin-embedded section of human lung cancer tissue.

    CCT3 Antibody

    IHC analysis of CCT3 using anti-CCT3 antibody.CCT3 was detected in paraffin-embedded section of human mammary cancer tissue.

    CCT3 Antibody

    IHC analysis of CCT3 using anti-CCT3 antibody.CCT3 was detected in paraffin-embedded section of human intestinal cancer tissue.

    CCT3 Antibody

    IHC analysis of CCT3 using anti-CCT3 antibody.CCT3 was detected in paraffin-embedded section of human placenta tissue.

    • CCT3 Antibody [orb1264526]

      FC,  IHC-P,  WB

      Bovine, Monkey, Mouse, Rat, Xenopus

      Human

      Rabbit

      Polyclonal

      Unconjugated

      400 μl
    • CCT3 antibody [orb34283]

      FC,  IHC-P,  WB

      Mouse, Other, Rat

      Human

      Rabbit

      Polyclonal

      Unconjugated

      80 μl
    • CCT3 antibody [orb247488]

      ICC,  IF,  WB

      Human, Mouse, Rat

      Polyclonal

      Unconjugated

      50 μl, 100 μl, 200 μl
    • CCT3 Antibody [orb1264527]

      FC,  IHC-P,  WB

      Bovine, Monkey

      Human

      Rabbit

      Polyclonal

      Unconjugated

      400 μl
    • CCT3 Antibody [orb1256941]

      IF,  IHC,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars