CCRL1 antibody

• Catalog Number: orb585220
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CCRL1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 39kDa
• Target: ACKR4
• UniProt ID: Q9NPB9
• Protein Sequence: Synthetic peptide located within the following region: SIALFHSCLNPILYVFMGASFKNYVMKVAKKYGSWRRQRQSVEEFPFDSE
• NCBI: NP_057641
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PPR1, CCBP2, CCR10, CCR11, CCRL1, VSHK1, CCR-11, C
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: human colon tissues infected ex-vivo with HIV-1, Green: Primary, Blue: DAPI, Primary dilution: 1:1000, Secondary Antibody: Donkey anti-Rabbit AF 488, Secondary dilution: 1:500.

CCRL1 antibody - C-terminal region (orb585220) validated by WB using 293T cell Lysate at 1 ug/ml.