CCR8 antibody

• Catalog Number: orb592768
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CCR8
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Rabbit
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCR8
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 41kDa
• Target: CCR8
• UniProt ID: P51685
• Protein Sequence: Synthetic peptide located within the following region: MATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFT
• NCBI: NP_005192
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CY6, TER1, CCR-8, CKRL1, CDw198, CMKBR8, GPRCY6, C
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: CCR8, Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-CCR8 Antibody Titration: 2.5 ug/ml, Positive Control: K562 cell lysate. CCR8 is supported by BioGPS gene expression data to be expressed in K562.