You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592768 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CCR8 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Rabbit |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CCR8 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 41kDa |
Target | CCR8 |
UniProt ID | P51685 |
Protein Sequence | Synthetic peptide located within the following region: MATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFT |
NCBI | NP_005192 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CY6, TER1, CCR-8, CKRL1, CDw198, CMKBR8, GPRCY6, C Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: CCR8, Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.
WB Suggested Anti-CCR8 Antibody Titration: 2.5 ug/ml, Positive Control: K562 cell lysate. CCR8 is supported by BioGPS gene expression data to be expressed in K562.
ICC, IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
Filter by Rating