CCR5 purified MaxPab mouse polyclonal antibody (B02P)

• Catalog Number: orb2294311
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human CCR5 protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: FC, WB
• Reactivity: Human
• Immunogen: CCR5 (XP_001125981.1, 1 a.a. ~ 352 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
• NCBI: XP_001125981.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CCR5 MaxPab polyclonal antibody. Western Blot analysis of CCR5 expression in HeLa.

FACS analysis of negative control 293 cells (Black) and CCR5 expressing 293 cells (Green) using CCR5 purified MaxPab mouse polyclonal antibody.

Western Blot analysis of CCR5 expression in transfected 293T cell line by CCR5 MaxPab polyclonal antibody. Lane 1: CCR5 transfected lysate(40.05 KDa). Lane 2: Non-transfected lysate.