CCR5 antibody

• Catalog Number: orb573684
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CCR5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Human, Porcine
• Reactivity: Bovine, Human, Porcine
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCR5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 41kDa
• Target: CCR5
• UniProt ID: P51681
• Protein Sequence: Synthetic peptide located within the following region: SHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKK
• NCBI: NP_000570
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CKR5, CCR-5, CD195, CKR-5, CCCKR5, CMKBR5, IDDM22,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: CCR5, Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: CCR5, Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: CCR5, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-CCR5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human heart.