You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573684 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CCR5 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Human, Porcine |
Reactivity | Bovine, Human, Porcine |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CCR5 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 41kDa |
Target | CCR5 |
UniProt ID | P51681 |
Protein Sequence | Synthetic peptide located within the following region: SHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKK |
NCBI | NP_000570 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CKR5, CCR-5, CD195, CKR-5, CCCKR5, CMKBR5, IDDM22, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: CCR5, Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: CCR5, Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: CCR5, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-CCR5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human heart.
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating