CCNB1 antibody

• Catalog Number: orb573589
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CCNB1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IP, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CCNB1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 48kDa
• Target: CCNB1
• UniProt ID: P14635
• Protein Sequence: Synthetic peptide located within the following region: YTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS
• NCBI: NP_114172
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CCNB
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-CCNB1 Antibody, Catalog Number: orb573589, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Application: IP, Species+tissue/cell type: Mouse brain homogenate, How many ug'sof tissue/cell lysate run on the gel: 500 ug mouse brain homogenateIP antibody: 6 ug, Primary antibody dilution: 1:500, Secondary antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:5000.

Application:Western blotting, Species+tissue/cell type: lane 1: 60 ug human NT2 cell line, Primary antibody dilution: 1:500, Secondary antibody:IRDye 800 CW goat anti-rabbit, Secondary antibody dilution: 1:20000.

WB Suggested Anti-CCNB1 Antibody, Positive Control: Lane 1: 60 ug human NT2 cell line, Primary Antibody Dilution: 1:500, Secondary Antibody: IRDye 800 CW goat anti-rabbit, Secondry Antibody Dilution: 1:20000.

WB Suggested Anti-CCNB1 Antibody Titration: 0.125 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, CCNB1 is supported by BioGPS gene expression data to be expressed in Jurkat.