You have no items in your shopping cart.
Cart summary
CCL8 Protein, Human, Recombinant (Active)
Catalog Number: orb2816354
| Catalog Number | orb2816354 |
|---|---|
| Category | Proteins |
| Description | CCL8 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P80075. |
| Tag | Tag Free |
| MW | 8.9 kDa (Predicted) |
| UniProt ID | P80075 |
| Protein Sequence | QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP |
| Expression System | E. coli |
| Biological Origin | Human |
| Expression Region | 24-99 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human CCL8 protein (Active) [orb359073]
> 96% as determined by SDS-PAGE and HPLC.
8.9 kDa
E.Coli
10 μg, 100 μg, 500 μg Recombinant Human C-C motif chemokine 8 protein(CCL8) (Active) [orb1650785]
500 μg, 10 μg, 100 μg, 1 mg, 250 μg
