You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592724 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CCL8 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CCL8 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 11 kDa |
Target | CCL8 |
UniProt ID | P80075 |
Protein Sequence | Synthetic peptide located within the following region: SYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP |
NCBI | NP_005614 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HC14, MCP2, MCP-2, SCYA8, SCYA10 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target: CCL8, Positive control (+): Human Fetal Heart (HE), Negative control (-): HeLa Cell Lysate (HL), Antibody concentration: 1 ug/ml.
Rabbit Anti-CCL8 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Adrenal, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0sec.
WB Suggested Anti-CCL8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart.
ELISA, IF, IHC-Fr, IHC-P | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating